CDS2protein







Upload a file
Select a file


Code tables: *


  Email me when task completed.

 The number of coins consumed at one time is 1



Function:
Translating CDS to protein according to the Standard Code (transl_table=1) or the Bacterial, Archaeal and Plant Plastid Code (transl_table=11).


Input:
Input directly or upload CDS sequences in FASTA format.


Parameters:
Choose the type of code tables. Table NO.1 and NO.11 are available now.


Output:


The protein sequence would be output in FASTA format.

Example file (right click to download):example file


Input the CDS sequence, and choose code table 1.

>NF53_0002
ATGCGTTTTACAATACAAAAAGACTATCTTGTAAGAGGTGTACAAGATGTAATGAAGGCA
GTTTCTTCTCGTACAACAATCCCCATCCTTACGGGAATTAAAGTTGTAGCTACTGAAGAA
GGGGTTACATTAACAGGAAGCGATGCTGATATTTCTATTGAATCGTTTATTCCAGTCGAA
GAAGATGGAAAAGAAATCGTAGAAATTGCTCAATCAGGAAGCATTGTTTTACAGGCAAAA
TATTTTAGTGAGATTGTAAAAAAACTACCTAAAGACACTGTCGAAATTTCTGTAGAAAAT
CATTTTATGACAAAAATAAAATCTGGAAAATCAGAGTTTAACTTAAATGGTTTAGATTCT
GCAGAATATCCGTTATTGCCACAGATTGAAGAACATCATGTATTTAAGATACCAACAGAT
TTACTTAAGCATATGATCAGACAAACTGTATTTGCAGTTTCTACTTCTGAAACAAGACCG
ATCTTGACAGGTGTAAACTGGAAGGTATATAACAGCGAGTTAACTTGTATTGCAACAGAT
AGTCATAGACTGGCACTTCGAAAAGCAAAAATTGAAGGACATAACATTGCAGATGAATTC
CAAGCTAATGTTGTTATTCCAGGTAAGAGCTTAAATGAATTAAGTAAAATTTTAGATGAG
TCTGAAGAAATGGTAGATATCGTTATTACGGAGTATCAAGTATTATTCCGTACAAAACAT
TTATTATTCTTCTCAAGATTGTTAGAAGGAAATTATCCTGATACGACACGTTTAATTCCA
GCAGAGAGTAAAACGGATATTTTTGTAAATACAAAAGAATTCCTACAAGCAATTGATCGT
GCTTCACTATTAGCAAGAGATGGCCGCAATAACGTTGTTAAATTATCAACTTTAGAGCAA
GAAATGCTAGAGATTTCTTCGAATTCACCAGAAATCGGAAAAGTTGTCGAAGAAGTACAA
TGCGAAAAAGTAGATGGAGAAGAGTTAAAAATATCTTTTAGTGCAAAATATATGATGGAT
GCATTAAAAGCTTTGGATAGTACAGAGATTAAAGTTAGCTTTACTGGGGCAATGAGACCG
TTCTTAATTCGTACAGTAAATGATGATTCAATTATTCAATTAATTTTACCGGTTCGTACT
TACTAG
    

The output protein sequence like this:

>NF53_0002
MRFTIQKDYLVRGVQDVMKAVSSRTTIPILTGIKVVATEEGVTLTGSDADISIESFIPVE
EDGKEIVEIAQSGSIVLQAKYFSEIVKKLPKDTVEISVENHFMTKIKSGKSEFNLNGLDS
AEYPLLPQIEEHHVFKIPTDLLKHMIRQTVFAVSTSETRPILTGVNWKVYNSELTCIATD
SHRLALRKAKIEGHNIADEFQANVVIPGKSLNELSKILDESEEMVDIVITEYQVLFRTKH
LLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDGRNNVVKLSTLEQ
EMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDALKALDSTEIKVSFTGAMRP
FLIRTVNDDSIIQLILPVRTY